PADI2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37918

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PADI2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PADI2 Antibody - BSA Free

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918] - Analysis in human rectum and liver tissues using NBP2-37918 antibody. Corresponding PADI2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918]

Immunohistochemistry-Paraffin: PADI2 Antibody [NBP2-37918] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for PADI2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PADI2

PADI2 / PAD2 is a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. Each family member has a distinct substrate specificity and tissue expression pattern. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative disorders, including Alzheimers disease and multiple sclerosis, and it has also been implicated in the pathogenesis of glaucoma.

Long Name

Peptidyl Arginine Deiminase type II

Alternate Names

PAD-H19, PAD2, PDI2, Peptidylarginine Deiminase II

Gene Symbol

PADI2

UniProt

Q9Y2J8 (Human)

Additional PADI2 Products

Product Documents for PADI2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PADI2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics

Customer Reviews for PADI2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PADI2 Antibody - BSA Free and earn rewards!

Have you used PADI2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies