PAG3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25039

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein PAG3 using the following amino acid sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAG3 Antibody - BSA Free

PAG3 Antibody Immunocytochemistry/Immunofluorescence: PAG3 Antibody [NBP3-25039]

Immunocytochemistry/Immunofluorescence: PAG3 Antibody [NBP3-25039]

Staining of human cell line SH-SY5Y shows localization to cytosol.

Applications for PAG3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAG3

PAG3 encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain. The protein localizes in the Golgi apparatus and at the plasma membrane, where it colocalizes with protein tyrosine kinase 2-beta (PYK2). The encoded protein forms a stable complex with PYK2 in vivo. This interaction appears to be mediated by binding of its SH3 domain to the C-terminal proline-rich domain of PYK2. The encoded protein is tyrosine phosphorylated by activated PYK2. It has catalytic activity for class I and II ArfGAPs in vitro, and can bind the class III Arf ARF6 without immediate GAP activity. The encoded protein is believed to function as an ARF GAP that controls ARF-mediated vesicle budding when recruited to Golgi membranes. In addition, it functions as a substrate and downstream target for PYK2 and SRC, a pathway that may be involved in the regulation of vesicular transport. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, centaurin, beta 3, CENTB3, DDEF2FLJ42910, development and differentiation enhancing factor 2, Development and differentiation-enhancing factor 2, KIAA0400AMAP2, Pap-alpha, PAPPAG3, Paxillin-associated protein with ARF GAP activity 3, PYK2 C terminus-associated protein, Pyk2 C-terminus-associated protein, SHAG1

Gene Symbol

ASAP2

Additional PAG3 Products

Product Documents for PAG3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAG3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAG3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAG3 Antibody - BSA Free and earn rewards!

Have you used PAG3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...