PAK4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58833

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAGHSEAGGGSGDRR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PAK4 Antibody - BSA Free (NBP2-58833) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PAK4 Antibody - BSA Free

Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PAK4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: PAK4 Antibody [NBP2-58833]

Immunocytochemistry/ Immunofluorescence: PAK4 Antibody [NBP2-58833]

Immunocytochemistry/Immunofluorescence: PAK4 Antibody [NBP2-58833] - Staining of human cell line MCF7 shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833]

Western Blot: PAK4 Antibody [NBP2-58833] - Analysis using Anti-PAK4 antibody NBP2-58833 (A) shows similar pattern to independent antibody NBP2-56634 (B).

Applications for PAK4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAK4

p21-activated kinases (PAKs) belong to the family of serine/threonine kinases involved in the control of various cellular processes, including the cell cycle, dynamics of the cytoskeleton, apoptosis, oncogenic transformation, and transcription. All PAK family members are characterized by the presence of p21-binding domain. p21-activated kinases are regulated by the small GTP-binding proteins Rac and Cdc42, and lipids, which stimulate autophosphorylation and phosphorylation of exogenous substrates. Serine (Ser-474) is the likely autophosphorylation site in the kinase domain of PAK4 in vivo. Phosphospecific antibodies directed against serine 474 detect activated PAK4 on the Golgi membrane when PAK4 is co-expressed with activated Cdc42. Current data strongly implicates PAK-4 in oncogenesis. PAK4 is frequently overexpressed in human tumor cell lines of various tissue origins.

Long Name

p21/Cdc42/Rac1-activated Kinase 4

Alternate Names

EC 2.7.11, EC 2.7.11.1, KIAA1142, p21 protein (Cdc42/Rac)-activated kinase 4, p21(CDKN1A)-activated kinase 4, p21-activated kinase 4, PAK-4, protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs, serine/threonine-protein kinase PAK 4

Gene Symbol

PAK4

Additional PAK4 Products

Product Documents for PAK4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAK4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PAK4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAK4 Antibody - BSA Free and earn rewards!

Have you used PAK4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...