PAPOLG Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55534

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PAPOLG Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQLHHYLPAEILQKKKKQSLSDVNRSSGGLQSKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAPOLG Antibody - BSA Free

Western Blot: PAPOLG Antibody [NBP2-55534]

Western Blot: PAPOLG Antibody [NBP2-55534]

Western Blot: PAPOLG Antibody [NBP2-55534] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: PAPOLG Antibody [NBP2-55534]

Immunocytochemistry/ Immunofluorescence: PAPOLG Antibody [NBP2-55534]

Immunocytochemistry/Immunofluorescence: PAPOLG Antibody [NBP2-55534] - Staining of human cell line U-2 OS shows localization to nucleus.

Applications for PAPOLG Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAPOLG

PAPOLG is a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level. These two enzymes have similar organization of structural and functional domains. This enzyme is exclusively localized in the nucleus and exhibits both nonspecific and CPSF (cleavage and polyadenylation specificity factor)/AAUAAA-dependent polyadenylation activity. This gene is located on chromosome 2 in contrast to the PAPII gene, which is located on chromosome 14

Alternate Names

EC 2.7.7.19, FLJ11805, FLJ12972, FLJ13482, FLJ14187, MGC133307, MGC133308, Neo-PAP, Neo-poly(A) polymerase, nuclear poly(A) polymerase gamma, PAP2, PAPG, PAP-gamma, poly(A) polymerase gamma, Polynucleotide adenylyltransferase gamma, SRP RNA 3' adenylating enzyme/pap2, SRP RNA 3'-adenylating enzyme

Gene Symbol

PAPOLG

Additional PAPOLG Products

Product Documents for PAPOLG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PAPOLG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAPOLG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAPOLG Antibody - BSA Free and earn rewards!

Have you used PAPOLG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies