PAQR5 Antibody (1F4) - Azide and BSA Free

Novus Biologicals | Catalog # H00054852-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1F4

Format

Azide and BSA Free
View all PAQR5 Primary Antibodies »

Product Specifications

Immunogen

PAQR5 (NP_060175, 1 a.a. ~ 51 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESGVAAAREECLVSGLPVLSPRPVHWTPETLGTQDTIGETGHFTKDLTGM*

Specificity

PAQR5 (1F4)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for PAQR5 Antibody (1F4) - Azide and BSA Free

Western Blot: PAQR5 Antibody (1F4) [H00054852-M01]

Western Blot: PAQR5 Antibody (1F4) [H00054852-M01]

Western Blot: PAQR5 Antibody (1F4) [H00054852-M01] - Detection against Immunogen (31.61 KDa).

Applications for PAQR5 Antibody (1F4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PAQR5

The steroid progesterone induces the resumption of maturation in oocytes via a nongenomic pathway through binding to a novel, membrane progestin receptor (mPR). This pathway inhibits adenylyl cyclase and reduces intracellular cAMP, and also activates mitogen-activated protein kinase to effect signal transduction pathways. Three distinct groups, designated alpha, beta, and gamma, comprise this gene family. While all contain 7 transmembrane domains, they show distinct distributions in reproductive, neural, kidney and intestinal tissues. These characteristics separate them from nuclear progestin receptors, and instead imply similarity to G-protein coupled receptors.

Alternate Names

membrane progestin receptor gamma, MPRGFLJ20190, Progestin and adipoQ receptor family member 5, progestin and adipoQ receptor family member VmPR gamma

Entrez Gene IDs

54852 (Human)

Gene Symbol

PAQR5

OMIM

607781 (Human)

UniProt

NP_060175 (Human)

Additional PAQR5 Products

Product Documents for PAQR5 Antibody (1F4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PAQR5 Antibody (1F4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAQR5 Antibody (1F4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PAQR5 Antibody (1F4) - Azide and BSA Free and earn rewards!

Have you used PAQR5 Antibody (1F4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies