PAR4, also known as F2RL3 and Coagulation Factor II (Thrombin) Receptor-like 3, is a member of the Protease-activated Receptor (PAR) family of seven transmembrane G protein-coupled receptors that are activated by proteolysis. It is 385 amino acids (aa) in length with a predicted molecular weight of 41.1 kDa. Human PAR4 shares 78% aa sequence identity with the mouse ortholog. PAR4 is widely expressed with highest expression levels being found in the lungs, pancreas, thyroid, testis, and small intestine. It is also observed in platelets, megakaryocytes, and leukocytes. PAR4 is activated by Thrombin, Trypsin, and Cathepsin G. These proteases bind to and cleave the N-terminal extracellular domain of PAR4 to generate a new N-terminus. This new N-terminus then functions as a tethered peptide ligand that binds to and activates the receptor. PAR4 is coupled to G proteins containing the alphaq and alpha12/13 subunits and has been shown to activate the PLC-IP3-Ca2+ and PLC-DAG-PKC signal transduction pathways. PAR4 plays an essential role in hemostasis and thrombosis. Interestingly, PAR4 requires PAR3 as a cofactor to achieve optimal Thrombin-induced platelet activation. PAR4 has also been suggested to be involved in regulation of gastrointestinal motility, modulation of nociceptive responses, and stimulation of epithelial to mesenchymal transition in alveolar epithelial cells. Down-regulation of PAR4 expression occurs frequently in gastric cancers and is associated with an aggressive progression of gastric cancer.
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PAR4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: PAR4 Antibody [NBP3-17410]
Immunocytochemistry/Immunofluorescence: PAR4 Antibody [NBP3-17410] - Staining of human cell line HEL shows localization to plasma membrane.Applications for PAR4 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PAR4
Long Name
Protease-Activated Receptor 4
Alternate Names
F2RL3, Protease-Activated Receptor 4, Thrombin Receptor-like 3
Gene Symbol
F2RL3
Additional PAR4 Products
Product Documents for PAR4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PAR4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for PAR4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PAR4 Antibody - BSA Free and earn rewards!
Have you used PAR4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...