PAR4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17410

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: SAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAR4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PAR4 Antibody [NBP3-17410]

Immunocytochemistry/ Immunofluorescence: PAR4 Antibody [NBP3-17410]

Immunocytochemistry/Immunofluorescence: PAR4 Antibody [NBP3-17410] - Staining of human cell line HEL shows localization to plasma membrane.

Applications for PAR4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAR4

PAR4, also known as F2RL3 and Coagulation Factor II (Thrombin) Receptor-like 3, is a member of the Protease-activated Receptor (PAR) family of seven transmembrane G protein-coupled receptors that are activated by proteolysis. It is 385 amino acids (aa) in length with a predicted molecular weight of 41.1 kDa. Human PAR4 shares 78% aa sequence identity with the mouse ortholog. PAR4 is widely expressed with highest expression levels being found in the lungs, pancreas, thyroid, testis, and small intestine. It is also observed in platelets, megakaryocytes, and leukocytes. PAR4 is activated by Thrombin, Trypsin, and Cathepsin G. These proteases bind to and cleave the N-terminal extracellular domain of PAR4 to generate a new N-terminus. This new N-terminus then functions as a tethered peptide ligand that binds to and activates the receptor. PAR4 is coupled to G proteins containing the alphaq and alpha12/13 subunits and has been shown to activate the PLC-IP3-Ca2+ and PLC-DAG-PKC signal transduction pathways. PAR4 plays an essential role in hemostasis and thrombosis. Interestingly, PAR4 requires PAR3 as a cofactor to achieve optimal Thrombin-induced platelet activation. PAR4 has also been suggested to be involved in regulation of gastrointestinal motility, modulation of nociceptive responses, and stimulation of epithelial to mesenchymal transition in alveolar epithelial cells. Down-regulation of PAR4 expression occurs frequently in gastric cancers and is associated with an aggressive progression of gastric cancer.

Long Name

Protease-Activated Receptor 4

Alternate Names

F2RL3, Protease-Activated Receptor 4, Thrombin Receptor-like 3

Gene Symbol

F2RL3

Additional PAR4 Products

Product Documents for PAR4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAR4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAR4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAR4 Antibody - BSA Free and earn rewards!

Have you used PAR4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...