PARC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58049

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PARC Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WKPNHKDYYNCSAMVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PARC Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PARC Antibody [NBP2-58049]

Immunocytochemistry/ Immunofluorescence: PARC Antibody [NBP2-58049]

Immunocytochemistry/Immunofluorescence: PARC Antibody [NBP2-58049] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Applications for PARC Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICCIF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PARC

PARC is a cytoplasmic anchor protein in p53 associated protein complexes. PARC directly interacted and formed an approximately 1MD complex with p53 in the cytoplasm of unstressed cells. In the absence of stress, inactivation of PARC induced nuclear localization of endogenous p53 and activated p53 dependent apoptosis. Overexpression of PARC promoted cytoplasmic sequestration of ectopic p53. Furthermore, abnormal cytoplasmic localization of p53 was observed in a number of neuroblastoma cell lines; RNA interference-mediated reduction of endogenous PARC significantly sensitized these neuroblastoma cells in the DNA damage response. These results revealed that PARC is a critical regulator in controlling p53 subcellular localization and subsequent function.

Alternate Names

CUL-9, cullin 9, cullin-9, DKFZp686G1042, H7AP1DKFZp686P2024, p53-associated parkin-like cytoplasmic protein, PARCKIAA0708, parkin-like cytoplasmic p53 binding protein, RP3-330M21.2, UbcH7-associated protein 1

Gene Symbol

CUL9

Additional PARC Products

Product Documents for PARC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PARC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PARC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PARC Antibody - BSA Free and earn rewards!

Have you used PARC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies