Pax6 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-61411PEP
Key Product Details
Source
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP2-61411PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Pax6
Long Name
Alternate Names
Gene Symbol
Additional Pax6 Products
Product Documents for Pax6 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Pax6 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for Pax6 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review Pax6 Recombinant Protein Antigen and earn rewards!
Have you used Pax6 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for Pax6 Recombinant Protein Antigen
-
Q: What PAX6 antibody is recommend to use in ICC staining of human stem cells differentiated neural precursors?
A:
By performing a search on PAX6 then refining this to antibodies which have been validated with human samples and for ICC, I can see that we have three products to meet your requirements. You can see all three of these antibodies. These products are listed based on sales and citations, however all of our antibodies are covered by our 100% guarantee to work in the species and applications listed on our website and on our product datasheets. You can read more about our quality guarantee here.