PCDHA6 Antibody (1A3) - Azide and BSA Free

Novus Biologicals | Catalog # H00056142-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1A3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

PCDHA6 (NP_061732, 295 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTSLSLPVREDAQFGTVIA

Reactivity Notes

Human. Other species not tested.

Specificity

PCDHA6 (1A3)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for PCDHA6 Antibody (1A3) - Azide and BSA Free

Western Blot: PCDHA6 Antibody (1A3) [H00056142-M05]

Western Blot: PCDHA6 Antibody (1A3) [H00056142-M05]

Western Blot: PCDHA6 Antibody (1A3) [H00056142-M05] - Analysis of PCDHA6 expression in K-562 (Cat # L009V1).
ELISA: PCDHA6 Antibody (1A3) [H00056142-M05]

ELISA: PCDHA6 Antibody (1A3) [H00056142-M05]

ELISA: PCDHA6 Antibody (1A3) [H00056142-M05] - Detection limit for recombinant GST tagged PCDHA6 is approximately 0.3ng/ml as a capture antibody.

Applications for PCDHA6 Antibody (1A3) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PCDHA6

This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Alternate Names

CNR2, CNRN2, CNRS2, CRNR2, KIAA0345-like 8, PCDH-ALPHA6, PCDH-alpha-6, protocadherin alpha 6, protocadherin alpha-6

Entrez Gene IDs

56142 (Human)

Gene Symbol

PCDHA6

OMIM

606312 (Human)

Additional PCDHA6 Products

Product Documents for PCDHA6 Antibody (1A3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCDHA6 Antibody (1A3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCDHA6 Antibody (1A3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PCDHA6 Antibody (1A3) - Azide and BSA Free and earn rewards!

Have you used PCDHA6 Antibody (1A3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...