PCGF1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-16635

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 160-259 of human PCGF1 (NP_116062.2). AHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PCGF1 Antibody - Azide and BSA Free

Western Blot: PCGF1 AntibodyAzide and BSA Free [NBP3-16635]

Western Blot: PCGF1 AntibodyAzide and BSA Free [NBP3-16635]

Western Blot: PCGF1 Antibody [NBP3-16635] - Western blot analysis of extracts of various cell lines, using PCGF1 antibody (NBP3-16635) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
PCGF1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PCGF1 Antibody - Azide and BSA Free [NBP3-16635] -

Immunocytochemistry/ Immunofluorescence: PCGF1 Antibody - Azide and BSA Free [NBP3-16635] - Immunofluorescence analysis of U-2OS cells using PCGF1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for PCGF1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PCGF1

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors toregulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 (PubMed 11287196)). See alsoPCGF2 (MIM 600346).(supplied by OMIM)

Alternate Names

MGC10882, Nervous system Polycomb-1, NSPc1, NSPC1FLJ43754, polycomb group ring finger 1,2010002K04Rik, polycomb group RING finger protein 1, RING finger protein 68, RNF68RNF3A-2

Gene Symbol

PCGF1

Additional PCGF1 Products

Product Documents for PCGF1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCGF1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCGF1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PCGF1 Antibody - Azide and BSA Free and earn rewards!

Have you used PCGF1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...