PCID2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57674

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PCID2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PCID2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PCID2 Antibody [NBP2-57674]

Immunocytochemistry/ Immunofluorescence: PCID2 Antibody [NBP2-57674]

Immunocytochemistry/Immunofluorescence: PCID2 Antibody [NBP2-57674] - Staining of human cell line HeLa shows localization to nucleus & nucleoli.

Applications for PCID2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCID2

PCID2, also known as PCI domain-containing protein 2, belongs to the CSN12 family, is a protein with 4 isoforms ranging from a 376 amino acid that is 43 kDa to a 453 amino acid that is 52 kDa, regulates the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation necessary for B-cell survival. Disease research has shown correlation of this protein with malaria. This protein has been linked to the negative regulation of apoptotic process, regulation of mRNA stability, positive regulation of B cell differentiations, positive regulation of transcription, DNA-dependent and spleen development pathways where it interacts with KPNB1, SMAD2, BRF2, NEK6 and SHFM1 proteins.

Alternate Names

CSN12-like protein, DKFZp686C20226, F10, FLJ11305, FLJ99362, MGC16774, PCI domain containing 2, PCI domain-containing protein 2

Gene Symbol

PCID2

Additional PCID2 Products

Product Documents for PCID2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PCID2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCID2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCID2 Antibody - BSA Free and earn rewards!

Have you used PCID2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies