PDIA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49086

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PDIA2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against recombinant PDIA2 protein corresponding to amino acids: LIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PDIA2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PDIA2 Antibody [NBP2-49086]

Immunocytochemistry/ Immunofluorescence: PDIA2 Antibody [NBP2-49086]

Immunocytochemistry/Immunofluorescence: PDI Antibody [NBP2-49086] - Staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human lymph node.
Immunohistochemistry: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry: PDI Antibody [NBP2-49086] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining in human pancreas and colon tissues using anti-PDIA2 antibody. Corresponding PDIA2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human kidney, liver, lymph node and pancreas using Anti-PDIA2 antibody NBP2-49086 (A) shows similar protein distribution across tissues to independent antibody NBP2-49015 (B).
Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human liver.
Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDIA2 Antibody [NBP2-49086]

Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human kidney.

Applications for PDIA2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDIA2

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, two TRX-like domains and a C-terminal ER-retention sequence. The protein plays a role in the folding of nascent proteins in the endoplasmic reticulum by forming disulfide bonds through its thiol isomerase, oxidase, and reductase activity. The encoded protein also possesses estradiol-binding activity and can modulate intracellular estradiol levels.

Alternate Names

Pancreas-specific protein disulfide isomerase, pancreatic protein disulfide isomerase, PDA2, PDI, PDIp, PDIR, protein disulfide isomerase, pancreatic, protein disulfide isomerase-associated 2, protein disulfide-isomerase A2, Rho GDP dissociation inhibitor gamma

Gene Symbol

PDIA2

Additional PDIA2 Products

Product Documents for PDIA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDIA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PDIA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDIA2 Antibody - BSA Free and earn rewards!

Have you used PDIA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies