PDLIM4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37889

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PDLIM4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-210 of human PDLIM4 (NP_003678.2).

Sequence:
VSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPSGTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSRDCRVDLGSEVYRMLREPAEPVAAEPKQSGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PDLIM4 Antibody - BSA Free

PDLIM4 Antibody

Immunocytochemistry/ Immunofluorescence: PDLIM4 Antibody [NBP3-37889] -

Immunocytochemistry/ Immunofluorescence: PDLIM4 Antibody [NBP3-37889] - Immunofluorescence analysis of PC-12 cells using PDLIM4 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PDLIM4 Antibody

Western Blot: PDLIM4 Antibody [NBP3-37889] -

Western Blot: PDLIM4 Antibody [NBP3-37889] - Western blot analysis of various lysates using PDLIM4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for PDLIM4 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PDLIM4

PDLIM4, also known as PDZ and LIM domain protein 4, has 2 isoforms, a 330 amino acid long isoform that is 35 kDa and a short 246 amino acid isoform that is 26 kDa and found in brain. May be involved in bone development. Disease research is being performed on this protein involvement in osteoporosis, bronchiolitis, prostate cancer, prostatitis, multiple personality disorder, and asperger syndrome. The protein interacts with RBPMS, PTPN13, TRIP6, MYC, ZNF408, ABCA1, NFE2, SLC2A4, SSBP, TCF3, and ZBTB9 proteins.

Alternate Names

LIM domain protein, LIM protein RIL, PDZ and LIM domain 4, PDZ and LIM domain protein 4, Reversion-induced LIM protein, RILenigma homolog

Gene Symbol

PDLIM4

Additional PDLIM4 Products

Product Documents for PDLIM4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDLIM4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PDLIM4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDLIM4 Antibody - BSA Free and earn rewards!

Have you used PDLIM4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies