Recombinant Human PERP GST (N-Term) Protein

Novus Biologicals | Catalog # H00064065-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-193 of Human PERP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

47.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PERP GST (N-Term) Protein

SDS-PAGE: Recombinant Human PERP GST (N-Term) Protein [H00064065-P01]

SDS-PAGE: Recombinant Human PERP GST (N-Term) Protein [H00064065-P01]

SDS-Page: Recombinant Human PERP Protein [H00064065-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00064065-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: PERP

The p53 tumor suppressor activates either cell cycle arrest or apoptosis in response to cellular stress. A novel gene, PERP, is expressed in a p53-dependent manner and at high levels in apoptotic cells compared with G(1)-arrested cells. PERP induction is linked to p53-dependent apoptosis and is directly activated by p53. These data suggest that PERP is a novel effector of p53-dependent apoptosis.

Alternate Names

dJ496H19.1, KCP1KCP-1, Keratinocyte-associated protein 1, KRTCAP11110017A08Rik, p53 apoptosis effector related to PMP22, p53 apoptosis effector related to PMP-22, P53-induced protein PIGPC1, PERP, TP53 apoptosis effector, PIGPC1RP3-496H19.1, THWkeratinocytes associated protein 1, Transmembrane protein THW

Gene Symbol

PERP

Additional PERP Products

Product Documents for Recombinant Human PERP GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human PERP GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human PERP GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human PERP GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human PERP GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...