Pescadillo Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-55211
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Mouse
Predicted:
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Applications
Validated:
Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Pescadillo Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Pescadillo Antibody [NBP2-55211]
Immunocytochemistry/Immunofluorescence: Pescadillo Antibody [NBP2-55211] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -
beta ‐HB treatments decreased PES1‐facilitated VE‐cadherin ubiquitination in MVECs. (A–C) beta ‐HB increased the interaction between PES1 and VE‐cadherin. (D–G) Knockdown of Pes1 in cultured cells extenuated the ubiquitination of VE‐cadherin. (H–K) Overexpression of Pes1 in cultured cells promoted the ubiquitination of VE‐cadherin, which was curbed by beta ‐HB treatment. Each experiment was performed independently three times. ***p < 0.001 compared with control (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -
KD improved vascular hyperpermeability and reduced vascular stiffness and leakage in type 2 diabetic mice. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were performed for different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–H) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were detected by Immunoblotting. Data are represented as mean +/- SEM, each assay was performed independently three times (n = 12 per group). KD (ketogenic diet), SD (standard diet). **p < 0.01 C57BL/6J‐KD versus C57BL/6J‐SD, ***p < 0.001 C57BL/6J‐KD versus C57BL/6J‐SD, #p < 0.05 db/db‐KD versus db/db‐SD, ##p < 0.01 db/db‐KD versus db/db‐SD, ###p < 0.001 db/db‐KD versus db/db‐SD, +p < 0.05 C57BL/J‐SD versus db/db‐SD, ++p < 0.01 C57BL/J‐SD versus db/db‐SD, +++p < 0.001 C57BL/J‐SD versus db/db‐SD, &&p < 0.01 C57BL/6J‐KD versus db/db‐KD, &&&p < 0.001 C57BL/6J‐KD versus db/db‐KD (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -
Pes1 knockout in mice decreased vascular permeability. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were conducted in different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–F) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were measured by Immunoblotting. Data were represented as mean +/- SEM, each assay was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -
beta ‐HB treatments decreased PES1‐facilitated VE‐cadherin ubiquitination in MVECs. (A–C) beta ‐HB increased the interaction between PES1 and VE‐cadherin. (D–G) Knockdown of Pes1 in cultured cells extenuated the ubiquitination of VE‐cadherin. (H–K) Overexpression of Pes1 in cultured cells promoted the ubiquitination of VE‐cadherin, which was curbed by beta ‐HB treatment. Each experiment was performed independently three times. ***p < 0.001 compared with control (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -
beta ‐HB treatment reduced vascular endothelial paracellular permeability in vitro. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after 2 mM beta ‐HB treatment for 24 h. (C–H) Displayed are immunofluorescence images of beta ‐HB‐treated MVECs for VE‐cadherin, VEGF and PES1 expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (I) Exhibited is the paracellular permeability in the cultured MVECs under different treatments. Ctrl (Control), beta ‐HB ( beta ‐hydroxybutyric acid). Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -
In vitro knockdown of Pes1 lowered the paracellular permeability of MVECs. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after Pes1‐siRNA treatment. (C, D) Shown are immunofluorescence images of Pes1‐siRNA‐treated MVECs for Occludin and VE‐cadherin expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (E) Exhibited is the paracellular permeability in the cultured MVECs in different groups. Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Pescadillo Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Pescadillo
Alternate Names
pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain
Gene Symbol
PES1
Additional Pescadillo Products
Product Documents for Pescadillo Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Pescadillo Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Pescadillo Antibody - BSA Free
Customer Reviews for Pescadillo Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Pescadillo Antibody - BSA Free and earn rewards!
Have you used Pescadillo Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...