Pescadillo Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55211

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Mouse

Predicted:

Mouse (93%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Pescadillo Antibody - BSA Free

Western Blot: Pescadillo Antibody [NBP2-55211]

Western Blot: Pescadillo Antibody [NBP2-55211]

Western Blot: Pescadillo Antibody [NBP2-55211] - Analysis using Anti-PES1 antibody NBP2-55211 (A) shows similar pattern to independent antibody NBP2-34146 (B).
Immunocytochemistry/ Immunofluorescence: Pescadillo Antibody [NBP2-55211]

Immunocytochemistry/ Immunofluorescence: Pescadillo Antibody [NBP2-55211]

Immunocytochemistry/Immunofluorescence: Pescadillo Antibody [NBP2-55211] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Pescadillo Antibody - BSA Free

Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -

beta ‐HB treatments decreased PES1‐facilitated VE‐cadherin ubiquitination in MVECs. (A–C) beta ‐HB increased the interaction between PES1 and VE‐cadherin. (D–G) Knockdown of Pes1 in cultured cells extenuated the ubiquitination of VE‐cadherin. (H–K) Overexpression of Pes1 in cultured cells promoted the ubiquitination of VE‐cadherin, which was curbed by beta ‐HB treatment. Each experiment was performed independently three times. ***p < 0.001 compared with control (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Pescadillo Antibody - BSA Free

Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -

KD improved vascular hyperpermeability and reduced vascular stiffness and leakage in type 2 diabetic mice. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were performed for different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–H) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were detected by Immunoblotting. Data are represented as mean +/- SEM, each assay was performed independently three times (n = 12 per group). KD (ketogenic diet), SD (standard diet). **p < 0.01 C57BL/6J‐KD versus C57BL/6J‐SD, ***p < 0.001 C57BL/6J‐KD versus C57BL/6J‐SD, #p < 0.05 db/db‐KD versus db/db‐SD, ##p < 0.01 db/db‐KD versus db/db‐SD, ###p < 0.001 db/db‐KD versus db/db‐SD, +p < 0.05 C57BL/J‐SD versus db/db‐SD, ++p < 0.01 C57BL/J‐SD versus db/db‐SD, +++p < 0.001 C57BL/J‐SD versus db/db‐SD, &&p < 0.01 C57BL/6J‐KD versus db/db‐KD, &&&p < 0.001 C57BL/6J‐KD versus db/db‐KD (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Pescadillo Antibody - BSA Free

Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -

Pes1 knockout in mice decreased vascular permeability. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were conducted in different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–F) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were measured by Immunoblotting. Data were represented as mean +/- SEM, each assay was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Pescadillo Antibody - BSA Free

Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -

beta ‐HB treatments decreased PES1‐facilitated VE‐cadherin ubiquitination in MVECs. (A–C) beta ‐HB increased the interaction between PES1 and VE‐cadherin. (D–G) Knockdown of Pes1 in cultured cells extenuated the ubiquitination of VE‐cadherin. (H–K) Overexpression of Pes1 in cultured cells promoted the ubiquitination of VE‐cadherin, which was curbed by beta ‐HB treatment. Each experiment was performed independently three times. ***p < 0.001 compared with control (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Pescadillo Antibody - BSA Free

Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -

beta ‐HB treatment reduced vascular endothelial paracellular permeability in vitro. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after 2 mM beta ‐HB treatment for 24 h. (C–H) Displayed are immunofluorescence images of beta ‐HB‐treated MVECs for VE‐cadherin, VEGF and PES1 expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (I) Exhibited is the paracellular permeability in the cultured MVECs under different treatments. Ctrl (Control), beta ‐HB ( beta ‐hydroxybutyric acid). Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Pescadillo Antibody - BSA Free

Western Blot: Pescadillo Antibody - BSA Free [NBP2-55211] -

In vitro knockdown of Pes1 lowered the paracellular permeability of MVECs. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after Pes1‐siRNA treatment. (C, D) Shown are immunofluorescence images of Pes1‐siRNA‐treated MVECs for Occludin and VE‐cadherin expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (E) Exhibited is the paracellular permeability in the cultured MVECs in different groups. Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Pescadillo Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pescadillo

Pescadillo encodes a protein that is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.

Alternate Names

pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain

Gene Symbol

PES1

Additional Pescadillo Products

Product Documents for Pescadillo Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pescadillo Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Pescadillo Antibody - BSA Free

Customer Reviews for Pescadillo Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pescadillo Antibody - BSA Free and earn rewards!

Have you used Pescadillo Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...