PEX13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38204

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PEX13 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PEX13 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PEX13 Antibody [NBP2-38204]

Immunocytochemistry/ Immunofluorescence: PEX13 Antibody [NBP2-38204]

Immunocytochemistry/Immunofluorescence: PEX13 Antibody [NBP2-38204] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204] - Staining of human kidney.
Immunohistochemistry: PEX13 Antibody [NBP2-38204]

Immunohistochemistry: PEX13 Antibody [NBP2-38204]

Immunohistochemistry: PEX13 Antibody [NBP2-38204] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204] - Staining in human testis and pancreas tissues using anti-PEX13 antibody. Corresponding PEX13 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204] - Staining of human colon, kidney, liver and pancreas using Anti-PEX13 antibody NBP2-38204 (A) shows similar protein distribution across tissues to independent antibody NBP1-86321 (B).
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204] - Staining of human colon.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204]

Immunohistochemistry-Paraffin: PEX13 Antibody [NBP2-38204] - Staining of human liver.

Applications for PEX13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEX13

PEX13 is a component of the peroxisomal translocation machinery with PEX14 and PEX17. It functions as a docking factor for the predominantly cytoplasmnic PTS1 receptor. It is also involved in the import of PTS1 and PTS2 proteins.

Alternate Names

NALD, peroxin-13, peroxisomal biogenesis factor 13, peroxisomal membrane protein PEX13, peroxisome biogenesis factor 13, ZWS

Gene Symbol

PEX13

UniProt

Q92968 (Human)

Additional PEX13 Products

Product Documents for PEX13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PEX13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEX13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEX13 Antibody - BSA Free and earn rewards!

Have you used PEX13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies