PFKP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58537

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PFKP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV

Reactivity Notes

Mouse 85%, Rat 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PFKP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PFKP Antibody [NBP2-58537]

Immunocytochemistry/ Immunofluorescence: PFKP Antibody [NBP2-58537]

Immunocytochemistry/Immunofluorescence: PFKP Antibody [NBP2-58537] - Staining of human cell line MCF7 shows localization to cytosol.
PFKP Antibody

Western Blot: PFKP Antibody [NBP2-58537] -

Western Blot: PFKP Antibody [NBP2-58537] -Analysis in human cell line CACO-2.

Applications for PFKP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PFKP

The PFKP gene encodes the platelet isoform of phosphofructokinase (PFK) (ATP:D-fructose-6-phosphate-1-phosphotransferase, EC 2.7.1.11). PFK catalyzes the irreversible conversion of fructose-6-phosphate to fructose-1,6-bisphosphate and is a key regulatory enzyme in glycolysis. The PFKP gene, which maps to chromosome 10p, is also expressed in fibroblasts. See also the muscle (PFKM; MIM 610681) and liver (PFKL; MIM 171860) isoforms of phosphofructokinase, which map to chromosomes 12q13 and 21q22, respectively. Vora (1981) [PubMed 6451249] determined that full tetrameric phophofructokinase enzyme expressed in platelets can be composed of subunits P4, P3L, and P2L2.[supplied by OMIM]

Alternate Names

6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, EC 2.7.1, EC 2.7.1.11, PFK-CFLJ40226, PFKFplatelet type, Phosphofructokinase 1, phosphofructokinase, platelet, phosphohexokinase

Gene Symbol

PFKP

Additional PFKP Products

Product Documents for PFKP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PFKP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PFKP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PFKP Antibody - BSA Free and earn rewards!

Have you used PFKP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies