Recombinant Human PGC1 alpha GST (N-Term) Protein

Novus Biologicals | Catalog # H00010891-Q01

Novus Biologicals
100% Guarantee

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
View all PGC1 alpha Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 689-798 of Human PGC1 alpha

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human PGC1 alpha GST (N-Term) Protein

Recombinant Human, PGC1 alpha Protein [H00010891-Q01] - 12.5% SDS-PAGE using Recombinant Human PGC1 alpha Protein stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00010891-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: PGC1 alpha

Peroxisome proliferator-activated receptor-gamma coactivator 1-alpha (PGC-1alpha), PPAR-gamma coactivator 1-alpha, PPARGC-1-alpha (theoretical molecular weight 91 kDa) belongs to a family of transcription coactivators which includes two other proteins; PGC-1beta and PGC-1-related coactivators. PGC1 alpha interacts with various transcription factors (e.g., FOXO1, PPAR-(alpha, delta and gamma), LXR and FXR), promoting the transactivation of their specific target genes (1). As a transcription coactivator, PGC1 alpha is found in the nucleus where it interacts with transcriptional activators and chromatin modifiers such as p300/CBP and SRC-1 to induce targeted gene expression (1, 2). Transcription factors which interact with PGC1 alpha are involved in several functions related to cellular energy homeostasis including mitochondrial biogenesis, glucose and fatty acid metabolism, and skeletal muscle remodeling. Upstream regulators of PGC1 alpha activity include proteins that play a central role as energy sensors including SIRT1 and AMPK which, through different mechanisms, induce PGC1 alpha activity (3).

PGC1 alpha is highly expressed in skeletal muscle, cardiac muscle, and brown adipose tissue, all tissues with high oxidative capacity (1, 2). PGC1 alpha is also induced by energy taxing physiological states, for example increased physical activity, reduced body temperature, and reduced food intake (3). Because of its role in pathways controlling cellular energy expenditure, PGC1 alpha dysfunction has been associated with pathophysiological conditions such as type 2 diabetes and the metabolic syndrome (3).

References

1.Liang, H., & Ward, W. F. (2006). PGC-1alpha: A key regulator of energy metabolism. American Journal of Physiology - Advances in Physiology Education. https://doi.org/10.1152/advan.00052.2006

2.Arany, Z., He, H., Lin, J., Hoyer, K., Handschin, C., Toka, O.,... Spiegelman, B. M. (2005). Transcriptional coactivator PGC-1alpha controls the energy state and contractile function of cardiac muscle. Cell Metabolism. https://doi.org/10.1016/j.cmet.2005.03.002

3.Canto, C., & Auwerx, J. (2009). PGC-1alpha, SIRT1 and AMPK, an energy sensing network that controls energy expenditure. Current Opinion in Lipidology. https://doi.org/10.1097/MOL.0b013e328328d0a4

Long Name

Peroxisome Proliferator-activated Receptor gamma, Coactivator 1 alpha

Alternate Names

LEM6, PPARGC1A

Gene Symbol

PPARGC1A

Additional PGC1 alpha Products

Product Documents for Recombinant Human PGC1 alpha GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human PGC1 alpha GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human PGC1 alpha GST (N-Term) Protein

Customer Reviews for Recombinant Human PGC1 alpha GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human PGC1 alpha GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human PGC1 alpha GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human PGC1 alpha GST (N-Term) Protein

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Please differentiate to me between PPAR and PGC clearly. I am confused with the difference between these two

    A: Thank you very much for contacting Novus Biologicals technical support team and sharing your query on the differences between PGC-1 alpha and PPAR. These are two different proteins encoded by their respective genes and serves different functions. PGC-1 alpha (PGC1A or PPAR gamma coactivator 1-alpha) is a transcriptional co-activator for steroid receptors and nuclear receptors, and it regulates diverse aspects of cellular physiology. It up-regulates the transcriptional activity of PPAR-gamma /thyroid hormone receptor on the uncoupling protein promoter; regulates the key mitochondrial genes involved in adaptive thermogenesis; implicates in the metabolic reprogramming in response to nutrients availability through the coordination of the expression of a wide array of genes involved in the regulation of glucose and fatty acid metabolism. Among our PGC-1 alpha antibodies, NBP1-04676 is our best selling product with nice customer feedback and citations in at least 13 research publications. PPAR (PPAR alpha) on the other hand is a ligand-activated transcription factor which gets activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine, and oleylethanolamide (a naturally occurring lipid that regulates satiety), and acts as a key regulator of lipid metabolism. It also acts as a receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. It regulates the peroxisomal beta-oxidation pathway of fatty acids, and also functions as transcription activator for the ACOX1 and P450 genes. We have a variety of PPAR alpha antibodies. I hope you will find this information helpful but please let me know if I can support you with anything else from my end. Thank you very much for choosing Novus Biologicals as your quality reagent supplier and we wish you the best with your research projects.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes