PGD2 Synthase/PTGDS Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25049PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all PGD2 Synthase/PTGDS Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGD2 Synthase/PTGDS

Source: E.coli

Amino Acid Sequence: PRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25049It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25049PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PGD2 Synthase/PTGDS

Prostaglandin D Synthase (PTGDS), is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of amyloid-b plaques in Alzheimer's disease.

Long Name

Prostaglandin D2 Synthase

Alternate Names

Cerebrin-28, PDS, PGD2, PGDS2, PH2DISO, PTGDS

Gene Symbol

PTGDS

Additional PGD2 Synthase/PTGDS Products

Product Documents for PGD2 Synthase/PTGDS Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PGD2 Synthase/PTGDS Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PGD2 Synthase/PTGDS Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PGD2 Synthase/PTGDS Recombinant Protein Antigen and earn rewards!

Have you used PGD2 Synthase/PTGDS Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes