PHF11 Antibody (1J3E4)

Novus Biologicals | Catalog # NBP3-33467

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1J3E4
View all PHF11 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 40-321 of human PHF11 (NP_001035533.1).

Sequence:
MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PHF11 Antibody (1J3E4)

PHF11 Antibody (1J3E4)

Western Blot: PHF11 Antibody (1J3E4) [NBP3-33467] -

Western Blot: PHF11 Antibody (1J3E4) [NBP3-33467] - Western blot analysis of lysates from Mouse spleen, using [KD Validated] PHF11 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
PHF11 Antibody (1J3E4)

Western Blot: PHF11 Antibody (1J3E4) [NBP3-33467] -

Western Blot: PHF11 Antibody (1J3E4) [NBP3-33467] - Western blot analysis of lysates from wild type(WT) and PHF11 knockdown (KD) 293T cells, using [KD Validated] PHF11 Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for PHF11 Antibody (1J3E4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PHF11

These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot (see Application Notes below). However no additional claims are made for their ability to recognize native protein in any application.

Alternate Names

APY, BCAPIGHER, BRCA1 C-terminus-associated protein, IgE responsiveness (atopic), IGEL, IGER, NYREN34, NY-REN-34, NY-REN-34 antigen, PHD finger protein 11, Renal carcinoma antigen NY-REN-34

Gene Symbol

PHF11

Additional PHF11 Products

Product Documents for PHF11 Antibody (1J3E4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PHF11 Antibody (1J3E4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHF11 Antibody (1J3E4)

There are currently no reviews for this product. Be the first to review PHF11 Antibody (1J3E4) and earn rewards!

Have you used PHF11 Antibody (1J3E4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies