PHLPP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35806

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PHLPP2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1250-1323 of human PHLPP2 (NP_055835.2).

Sequence:
DSLNLIEVATEVPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFDTAL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

147 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PHLPP2 Antibody - BSA Free

PHLPP2 Antibody

Western Blot: PHLPP2 Antibody [NBP3-35806] -

Western Blot: PHLPP2 Antibody [NBP3-35806] - Western blot analysis of various lysates using PHLPP2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
PHLPP2 Antibody

Immunocytochemistry/ Immunofluorescence: PHLPP2 Antibody [NBP3-35806] -

Immunocytochemistry/ Immunofluorescence: PHLPP2 Antibody [NBP3-35806] - Immunofluorescence analysis of L929 cells using PHLPP2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for PHLPP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PHLPP2

PHLPP2 contains 21 LRR (leucine rich) repeats, 1 PH domain and 1 PP2C like domain. It is a protein phosphatase that specifically mediates dephosphorylation of AKT1 Ser 473, a protein that regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro and antiapoptotic genes. Dephosphorylation of Ser 473 of AKT1 triggers apoptosis and decrease cell proliferation. PHLPP2 also controls the phosphorylation of AKT3. It binds 2 manganese ions per subunit. There are 3 named isoforms produced by alternative splicing.

Alternate Names

EC 3.1.3.16, KIAA0931PH domain leucine-rich repeat-containing protein phosphatase 2, PH domain and leucine rich repeat protein phosphatase 2, PH domain and leucine rich repeat protein phosphatase-like, PH domain leucine-rich repeat-containing protein phosphatase-like, PHLPPLPHLPP-like

Gene Symbol

PHLPP2

Additional PHLPP2 Products

Product Documents for PHLPP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PHLPP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHLPP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHLPP2 Antibody - BSA Free and earn rewards!

Have you used PHLPP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies