Recombinant Human Phospholipase A2 XII GST (N-Term) Protein

Novus Biologicals | Catalog # H00081579-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-189 of Human PLA2G12A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

47.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Phospholipase A2 XII GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00081579-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Phospholipase A2 XII

Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]).[supplied by OMIM]

Alternate Names

EC 3.1.1.4, group XII secreted phospholipase A2, group XIIA secreted phospholipase A2, group XIIA secretory phospholipase A2, GXII, GXII sPLA2, Phosphatidylcholine 2-acylhydrolase 12A, phospholipase A2, group XII, phospholipase A2, group XIIA, PLA2G12, ROSSY, sPLA2-XII

Gene Symbol

PLA2G12A

Additional Phospholipase A2 XII Products

Product Documents for Recombinant Human Phospholipase A2 XII GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Phospholipase A2 XII GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Phospholipase A2 XII GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Phospholipase A2 XII GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human Phospholipase A2 XII GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human Phospholipase A2 XII GST (N-Term) Protein

Showing  1 - 2 of 2 FAQs Showing All
  • Q:

    Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies recognize other phospholipases?

    A: Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

  • Q: Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies?

    A: Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

  • Q:

    Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies recognize other phospholipases?

    A: Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

  • Q: Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies?

    A: Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...