PIGM Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94070

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 35-96 of human PIGM (NP_660150.1). YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PIGM Antibody - Azide and BSA Free

Western Blot: PIGM AntibodyAzide and BSA Free [NBP2-94070]

Western Blot: PIGM AntibodyAzide and BSA Free [NBP2-94070]

Western Blot: PIGM Antibody [NBP2-94070] - Analysis of extracts of various cell lines, using PIGM at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.
Immunocytochemistry/ Immunofluorescence: PIGM Antibody - Azide and BSA Free [NBP2-94070]

Immunocytochemistry/ Immunofluorescence: PIGM Antibody - Azide and BSA Free [NBP2-94070]

Immunocytochemistry/Immunofluorescence: PIGM Antibody [NBP2-94070] - Analysis of L929 cells using PIGM at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PIGM Antibody - Azide and BSA Free [NBP2-94070]

Immunohistochemistry-Paraffin: PIGM Antibody - Azide and BSA Free [NBP2-94070]

Immunohistochemistry-Paraffin: PIGM Antibody [NBP2-94070] - Mouse kidney using PIGM Rabbit pAb (NBP2-94070) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: PIGM Antibody - Azide and BSA Free [NBP2-94070]

Immunohistochemistry-Paraffin: PIGM Antibody - Azide and BSA Free [NBP2-94070]

Immunohistochemistry-Paraffin: PIGM Antibody [NBP2-94070] - Rat kidney using PIGM Rabbit pAb (NBP2-94070) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for PIGM Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PIGM

PIGM, also known as GPI mannosyltransferase 1, is 423 amino acids long and approximately 49 kDa. PIGM is implicated in the assembly of precursors for GPI biosynthesis. PIGL research is currently being conducted in relation to several diseases and disorders such as malaria, thrombosis and babesiosis. PIGM has been shown to have interactions with ACTB, ACTG1, ALDH3A1, GIPC1 and PIGX in pathways such as GPI anchor biosynthesis and metabolic pathways.

Alternate Names

EC 2.4.1, EC 2.4.1.-, GPI mannosyltransferase 1, GPI mannosyltransferase I, GPI-MT-IPIG-M mannosyltransferase, MGC29896, phosphatidylinositol glycan anchor biosynthesis, class M, phosphatidylinositol glycan, class M, Phosphatidylinositol-glycan biosynthesis class M protein, PIG-M

Gene Symbol

PIGM

Additional PIGM Products

Product Documents for PIGM Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIGM Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for PIGM Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PIGM Antibody - Azide and BSA Free and earn rewards!

Have you used PIGM Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...