PIGW Antibody (1D8) - Azide and BSA Free

Novus Biologicals | Catalog # H00284098-M05-100ug

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1D8

Format

Azide and BSA Free
View all PIGW Primary Antibodies »

Product Specifications

Immunogen

PIGW (NP_848612.2, 399 a.a. ~ 447 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for PIGW Antibody (1D8) - Azide and BSA Free

Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug]

Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug]

Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection against Immunogen (31.13 KDa).
Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug]

Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug]

Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Analysis of PIGW expression in MCF-7.
ELISA: PIGW Antibody (1D8) [H00284098-M05-100ug]

ELISA: PIGW Antibody (1D8) [H00284098-M05-100ug]

ELISA: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection limit for recombinant GST tagged PIGW is 0.3 ng/ml as a capture antibody.

Applications for PIGW Antibody (1D8) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PIGW

Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]).[supplied by OMIM]

Alternate Names

class W, EC 2.3, FLJ37433, phosphatidylinositol glycan anchor biosynthesis, class W, PIG-W

Entrez Gene IDs

284098 (Human)

Gene Symbol

PIGW

OMIM

610275 (Human)

UniProt

NP_848612.2 (Human)

Additional PIGW Products

Product Documents for PIGW Antibody (1D8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIGW Antibody (1D8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIGW Antibody (1D8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PIGW Antibody (1D8) - Azide and BSA Free and earn rewards!

Have you used PIGW Antibody (1D8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies