PIK3C2G Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25052

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIK3C2G Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein PIK3C2G using the following amino acid sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PIK3C2G Antibody - BSA Free

PIK3C2G Antibody Immunocytochemistry/Immunofluorescence: PIK3C2G Antibody [NBP3-25052]

Immunocytochemistry/Immunofluorescence: PIK3C2G Antibody [NBP3-25052]

Staining of human cell line GAMG shows localization to plasma membrane.

Applications for PIK3C2G Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIK3C2G

PIK3C2G, also known as Phosphatidylinositol-4-Phosphate 3-Kinase, Catalytic Subunit Type 2 Gamma, is 1,485 amino acids long and approximately 171 kDa. PIK3C2G belongs to the PI 3-Kinase family. Although little is known about the function of PIK3C2G, PI3K family members play a role in the regulation of intracellular trafficking, cell survival and proliferation, and oncogenesis. PIK3C2G research is currently being conducted in relation to several diseases and disorders such as alcoholism, schizophrenia and Kaposi's sarcoma. PIK3C2G has been shown to have interactions with other PI3/PI4-kinase members such as PI4KA, PI4KB, PI4K2A, PI4K2B and PIP5K1B in pathways including the mTOR pathway, TGF-beta Pathway, NF-kappaB Pathway and Phosphatidylinositol signaling system.

Long Name

Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma

Alternate Names

PI3K-C2-gamma

Gene Symbol

PIK3C2G

Additional PIK3C2G Products

Product Documents for PIK3C2G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIK3C2G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIK3C2G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIK3C2G Antibody - BSA Free and earn rewards!

Have you used PIK3C2G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies