PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

Novus Biologicals | Catalog # H00005305-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3A3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

PIP5K2A (NP_005019, 304 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD

Localization

Cytoplasmic

Specificity

PIP5K2A - phosphatidylinositol-4-phosphate 5-kinase, type II, alpha

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

Western Blot: PIP5K2 alpha Antibody (3A3) [H00005305-M01]

Western Blot: PIP5K2 alpha Antibody (3A3) [H00005305-M01]

Western Blot: PIP5K2 alpha Antibody (3A3) [H00005305-M01] - PIP5K2A monoclonal antibody (M01), clone 3A3 Analysis of PIP5K2A expression in K-562.
Immunohistochemistry-Paraffin: PIP5K2 alpha Antibody (3A3) [H00005305-M01]

Immunohistochemistry-Paraffin: PIP5K2 alpha Antibody (3A3) [H00005305-M01]

Immunohistochemistry-Paraffin: PIP5K2 alpha Antibody (3A3) [H00005305-M01] - Analysis of monoclonal antibody to PIP5K2A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: PIP5K2 alpha Antibody (3A3) [H00005305-M01] - Detection limit for recombinant GST tagged PIP5K2A is approximately 3ng/ml as a capture antibody.

Applications for PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PIP5K2 alpha

Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family.

Alternate Names

1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-4-phosphate-5-kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide kinase 2-alpha, EC 2.7.1, EC 2.7.1.149, FLJ13267, phosphatidylinositol-4-phosphate 5-kinase, type II, alpha, Phosphatidylinositol-5-phosphate 4-kinase type II alpha, phosphatidylinositol-5-phosphate 4-kinase type-2 alpha, phosphatidylinositol-5-phosphate 4-kinase, type II, alpha, PI(5)P 4-kinase type II alpha, PIP4KII-alpha, PIP5K2, PIP5K2API5P4KA, PIP5KIIA, PIP5KIIalpha, PIP5KII-alpha, PIP5KIII, PIPK, PtdIns(4)P-5-kinase B isoform, PtdIns(4)P-5-kinase C isoform, PtdIns(5)P-4-kinase isoform 2-alpha, type II phosphatidylinositol-4-phosphate 5-kinase 53 K isoform

Entrez Gene IDs

5305 (Human)

Gene Symbol

PIP4K2A

OMIM

603140 (Human)

Additional PIP5K2 alpha Products

Product Documents for PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIP5K2 alpha Antibody (3A3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PIP5K2 alpha Antibody (3A3) - Azide and BSA Free and earn rewards!

Have you used PIP5K2 alpha Antibody (3A3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...