PIP5K2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56946

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIP5K2B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PIP5K2B Antibody - BSA Free

Western Blot: PIP5K2B Antibody [NBP2-56946]

Western Blot: PIP5K2B Antibody [NBP2-56946]

Western Blot: PIP5K2B Antibody [NBP2-56946] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: PIP5K2B Antibody [NBP2-56946]

Immunocytochemistry/ Immunofluorescence: PIP5K2B Antibody [NBP2-56946]

Immunocytochemistry/Immunofluorescence: PIP5K2B Antibody [NBP2-56946] - Staining of human cell line RH-30 shows localization to nucleoplasm.

Applications for PIP5K2B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIP5K2B

PIP5K2B, also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 beta, has a 416 amino acid long isoform that is approximately 47 kDa and a short 281 amino acid isoform that is approximately 32 kDa. PIP5K2B interacts with p55 TNF receptor and is implicated in the biosynthesis of PIP2, which is a phospholipid component of the plasma membrane. Current research on PIP5K2B is being conducted in relation to several diseases and disorders including breast cancer and ataxia. Research has shown that PIP5K2B has interactions with BTK, RAC1, RNPS1, UBQLN4 and TNF Receptor I in pathways such as calcium signaling, cAMP signaling, regulation of actin cytoskeleton, and Inositol phosphate metabolism.

Alternate Names

1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta, Diphosphoinositide kinase 2-beta, EC 2.7.1, EC 2.7.1.149, phosphatidylinositol-4-phosphate 5-kinase, type II, beta, Phosphatidylinositol-5-phosphate 4-kinase type II beta, phosphatidylinositol-5-phosphate 4-kinase type-2 beta, phosphatidylinositol-5-phosphate 4-kinase, type II, beta, PI(5)P 4-kinase type II beta, PI5P4KB, PIP4KII-beta, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PTDINS(4)P-5-kinase, PtdIns(5)P-4-kinase isoform 2-beta

Gene Symbol

PIP4K2B

Additional PIP5K2B Products

Product Documents for PIP5K2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIP5K2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIP5K2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIP5K2B Antibody - BSA Free and earn rewards!

Have you used PIP5K2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies