PKA 2 beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17753

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (95%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PKA 2 beta Antibody - BSA Free

Western Blot: PKA 2 beta Antibody [NBP3-17753]

Western Blot: PKA 2 beta Antibody [NBP3-17753]

Western Blot: PKA 2 beta Antibody [NBP3-17753] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: PKA 2 beta Antibody [NBP3-17753]

Immunocytochemistry/ Immunofluorescence: PKA 2 beta Antibody [NBP3-17753]

Immunocytochemistry/Immunofluorescence: PKA 2 beta Antibody [NBP3-17753] - Staining of human cell line SH-SY5Y shows localization to mitochondria.

Applications for PKA 2 beta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKA 2 beta

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.

Long Name

cAMP-dependent protein kinase type II-beta regulatory subunit

Alternate Names

PRKAR2B

Gene Symbol

PRKAR2B

Additional PKA 2 beta Products

Product Documents for PKA 2 beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PKA 2 beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PKA 2 beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PKA 2 beta Antibody - BSA Free and earn rewards!

Have you used PKA 2 beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...