PLA2G4A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38616

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PLA2G4A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PLA2G4A Antibody [NBP2-38616]

Immunocytochemistry/ Immunofluorescence: PLA2G4A Antibody [NBP2-38616]

Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP2-38616] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP2-38616]

Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP2-38616]

Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP2-38616] - Staining of human parathyroid gland shows moderate positivity in glandular cells.

Applications for PLA2G4A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLA2G4A

Secretory phopholipase A2 (PLA2) enzymes cleave an acyl ester bond in the sn-2 position of glycerophospholipids. These extracellular proteins have a high disulfide bond content, low molecular mass (14 kDa), and require mM levels of Ca2+ for catalysis. They play a crucial role in the generation of arachidonates and eicosanoids, and have a number of biological actions including immunological responses, inflammation, cellular proliferation, vasoconstriction, and bronchioconstriction.

Long Name

Phospholipase A2 Group IV A

Alternate Names

cPLA2, cPLA2-alpha

Gene Symbol

PLA2G4A

UniProt

Additional PLA2G4A Products

Product Documents for PLA2G4A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PLA2G4A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLA2G4A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PLA2G4A Antibody - BSA Free and earn rewards!

Have you used PLA2G4A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLA2G4A Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Hi. Actually I want to purchase anti cPLA2 antibody raised in rabbit which can bind to both phorphorylated and unphosphorylated mouse cPLA2 group IV. I want to a gel shift assay with western blotting to show that my protein of interest is causing the phosphorylation of cPLA2 inside the mouse macrophages RAW cells.Can you please tell me which antibody would be suitable for the purpose. Thanks a lot.

    A: Here are our antibodies raised in rabbit that have been validated to detect cPLA2 in mouse samples in a western blot. We have not specifically confirmed the ability of these antibodies to detect both the phosphorylated and unphosphorylated forms of the protein, and I cannot guarantee that they will clearly differentiate between the two.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

VEGF - VEGF R2 Signaling Pathways VEGF - VEGF R2 Signaling Pathway Thumbnail