Placental Lactogen/CSH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54710

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Placental Lactogen/CSH1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Placental Lactogen/CSH1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP2-54710]

Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP2-54710]

Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP2-54710] - Staining of human pituitary gland shows strong cytoplasmic positivity in cells in anterior lobe.

Applications for Placental Lactogen/CSH1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Placental Lactogen/CSH1

Placental lactogen is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites.

Alternate Names

Choriomammotropin, CSH1, CSMT, Lactogen, PL

Gene Symbol

CSH1

Additional Placental Lactogen/CSH1 Products

Product Documents for Placental Lactogen/CSH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Placental Lactogen/CSH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Placental Lactogen/CSH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Placental Lactogen/CSH1 Antibody - BSA Free and earn rewards!

Have you used Placental Lactogen/CSH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies