Plakophilin 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98523

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is plakophilin 4 - N-terminal region. Peptide sequence MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Plakophilin 4 Antibody - BSA Free

Western Blot: Plakophilin 4 Antibody [NBP1-98523]

Western Blot: Plakophilin 4 Antibody [NBP1-98523]

Western Blot: Plakophilin 4 Antibody [NBP1-98523] - Hela Cell Lysate 1.0ug/ml, Gel Concentration: 6-18%

Applications for Plakophilin 4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Plakophilin 4

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo'gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120(ctn)/plakophilin subfamily of Armadillo-like proteins, including CTNND1, CTNND2, PKP1, PKP2, PKP4, and ARVCF. PKP4 may be a component of desmosomal plaque and other adhesion plaques and is thought to be involved in regulating junctional plaque organization and cadherin function. Multiple transcript variants have been found for this gene, but the full-length nature of only two of them have been described so far.

Alternate Names

catenin 4, FLJ42243, p0071FLJ31261, plakophilin 4, plakophilin-4

Gene Symbol

PKP4

Additional Plakophilin 4 Products

Product Documents for Plakophilin 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Plakophilin 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Plakophilin 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Plakophilin 4 Antibody - BSA Free and earn rewards!

Have you used Plakophilin 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...