PLC-beta 3 Antibody (4C0Z7)

Novus Biologicals | Catalog # NBP3-15885

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4C0Z7 expressed in HEK293
View all PLC-beta 3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC-beta 3) (Q01970). RKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PLC-beta 3 Antibody (4C0Z7)

Western Blot: PLC-beta 3 Antibody (4C0Z7) [NBP3-15885]

Western Blot: PLC-beta 3 Antibody (4C0Z7) [NBP3-15885]

Western Blot: PLC-beta 3 Antibody (4C0Z7) [NBP3-15885] - Western blot analysis of extracts of various cell lines, using PLC beta 3 (PLC-beta 3) Rabbit mAb (NBP3-15885) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for PLC-beta 3 Antibody (4C0Z7)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PLC-beta 3

Phosphoinositide-specific phospholipase C (PLC) plays a critical role in the initiation of receptor mediated signal transduction through the generation of the two second messengers, inositol 1, 4, 5-triphosphate and diacylglycerol from phosphatidylinositol 4, 5 bisphosphate. A total of eight mammalian PLC isozymes have been described (PLC beta1, PLC beta2, PLC beta3, PLC beta4, PLC gamma1, PLC gamma2, PLC delta1 and PLC delta2) with molecular weights ranging from 85 to 150 kDa. The gamma-type enzymes are unique in that they contain SH2 and SH3 domains. Moreover, the two gamma-type enzymes, but not the beta and delta isozymes, are subject to activation by a number of protein tyrosine kinases which associate with their SH2 domains and induce their activation by phosphoryation. In contrast, activation of PLC beta1, PLC beta2 and PLC beta3 is mediated by the alpha subunits of the Gq class of heterotrimeric G proteins and by certain betagamma G protein subunits. The regulatory mechanisms for PLC delta1 and PLC delta2 are as yet not resolved.

Long Name

Phospholipase C beta 3

Alternate Names

PLCB3, PLCbeta 3

Gene Symbol

PLCB3

Additional PLC-beta 3 Products

Product Documents for PLC-beta 3 Antibody (4C0Z7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PLC-beta 3 Antibody (4C0Z7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLC-beta 3 Antibody (4C0Z7)

There are currently no reviews for this product. Be the first to review PLC-beta 3 Antibody (4C0Z7) and earn rewards!

Have you used PLC-beta 3 Antibody (4C0Z7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies