PMCA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87259

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PMCA3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSATSSVFSSSPGSPLHSVETS

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23416519)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PMCA3 Antibody - BSA Free

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-87259 antibody. Corresponding PMCA3 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: PMCA3 Antibody [NBP1-87259]

Immunocytochemistry/ Immunofluorescence: PMCA3 Antibody [NBP1-87259]

Immunocytochemistry/Immunofluorescence: PMCA3 Antibody [NBP1-87259] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & the Golgi apparatus.
Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebellum shows strong positivity in neuronal processes.
Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal processes.
Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259]

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for PMCA3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMCA3

The protein encoded by the PMCA3 gene belongs to the family of P-type primary ion transport ATPases characterized by theformation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ionsfrom eukaryotic cells against very large concentration gradients and play a critical role in intracellular calciumhomeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and thediversity of these enzymes is further increased by alternative splicing of transcripts. The expression of differentisoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting thatthese pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes theplasma membrane calcium ATPase isoform 3. Alternatively spliced transcript variants encoding different isoforms havebeen identified. (provided by RefSeq)

Alternate Names

ATPase, Ca++ transporting, plasma membrane 3, EC 3.6.3, EC 3.6.3.8, plasma membrane calcium ATPase, Plasma membrane calcium ATPase isoform 3, Plasma membrane calcium pump isoform 3, plasma membrane calcium-transporting ATPase 3, PMCA3a, PMCA3plasma membrane calcium pump

Gene Symbol

ATP2B3

Additional PMCA3 Products

Product Documents for PMCA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PMCA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PMCA3 Antibody - BSA Free

Customer Reviews for PMCA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMCA3 Antibody - BSA Free and earn rewards!

Have you used PMCA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PMCA3 Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All

  • Q: And, what kind of fix solution did your IF data use?

    A: I would recommend using the paraformaldehyde fixation if the results are inconclusive with the acetone-methanol fixation.

  • Q: I would like to know if this antibody can be stained the fixed sample by using aceton-methanol.

    A: For our product NBP1-87259, this antibody is made to the cytoplasmic domain of the PMCA3 protein. For our ICC staining, we fix the cells with 4% paraformaldehyde pH 7.2 - 7.3 in growth medium supplemented with 10% fetal bovine serum (FBS) for 15 minutes on ice. It is possible that a acetone-methanol fixation may also work as the antibody will detect an epitope on the cytoplasmic side of the cell membrane.

  • Q: And, what kind of fix solution did your IF data use?

    A: I would recommend using the paraformaldehyde fixation if the results are inconclusive with the acetone-methanol fixation.

  • Q: I would like to know if this antibody can be stained the fixed sample by using aceton-methanol.

    A: For our product NBP1-87259, this antibody is made to the cytoplasmic domain of the PMCA3 protein. For our ICC staining, we fix the cells with 4% paraformaldehyde pH 7.2 - 7.3 in growth medium supplemented with 10% fetal bovine serum (FBS) for 15 minutes on ice. It is possible that a acetone-methanol fixation may also work as the antibody will detect an epitope on the cytoplasmic side of the cell membrane.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies