PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free

Novus Biologicals | Catalog # H00005373-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 2E9

Format

Azide and BSA Free
View all PMM2/Phosphomannomutase 2 Primary Antibodies »

Product Specifications

Immunogen

PMM2 (NP_000294, 47 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIK

Specificity

PMM2 - phosphomannomutase 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free

Western Blot: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01]

Western Blot: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01]

Western Blot: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01] - Analysis of PMM2 expression in transfected 293T cell line by PMM2 monoclonal antibody (M01), clone 2E9.Lane 1: PMM2 transfected lysate(28.1 KDa).Lane 2: Non-transfected lysate.
ELISA: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01]

ELISA: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01]

ELISA: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01] - PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01] - Detection limit for recombinant GST tagged PMM2 is 0.1 ng/ml as a capture antibody.

Applications for PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PMM2/Phosphomannomutase 2

The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I.

Alternate Names

CDG1, CDG1a, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2

Entrez Gene IDs

5373 (Human)

Gene Symbol

PMM2

OMIM

212065 (Human)

UniProt

NP_000294 (Human)

Additional PMM2/Phosphomannomutase 2 Products

Product Documents for PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free

Customer Reviews for PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free and earn rewards!

Have you used PMM2/Phosphomannomutase 2 Antibody (2E9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies