PMP70 Antibody (3V4K3)

Novus Biologicals | Catalog # NBP3-16348

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3V4K3 expressed in HEK293
View all PMP70 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 560-659 of human PMP70 (P28288). GWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAVSVDVEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PMP70 Antibody (3V4K3)

Western Blot: PMP70 Antibody (3V4K3) [NBP3-16348]

Western Blot: PMP70 Antibody (3V4K3) [NBP3-16348]

Western Blot: PMP70 Antibody (3V4K3) [NBP3-16348] - Western blot analysis of extracts of various cell lines, using PMP70 Rabbit mAb (NBP3-16348) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348]

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348]

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348] - Immunofluorescence analysis of NIH-3T3 cells using PMP70 Rabbit mAb (NBP3-16348) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: PMP70 Antibody (3V4K3) [NBP3-16348]

Western Blot: PMP70 Antibody (3V4K3) [NBP3-16348]

Western Blot: PMP70 Antibody (3V4K3) [NBP3-16348] - Western blot analysis of extracts of various cell lines, using PMP70 Rabbit mAb (NBP3-16348) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348]

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348]

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348] - Immunofluorescence analysis of HeLa cells using PMP70 Rabbit mAb (NBP3-16348) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
PMP70 Antibody (3V4K3)

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348] -

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348] - Confocal imaging of C2C12 cells using PMP70 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
PMP70 Antibody (3V4K3)

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348] -

Immunocytochemistry/ Immunofluorescence: PMP70 Antibody (3V4K3) [NBP3-16348] - Confocal imaging of HeLa cells using PMP70 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for PMP70 Antibody (3V4K3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PMP70

PMP70 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Alternate Names

70 kDa peroxisomal membrane protein, ABC43, ATP-binding cassette, sub-family D (ALD), member 3, peroxisomal membrane protein 1 (70kD, Zellweger syndrome), Peroxisomal membrane protein-1 (70kD), PMP70ATP-binding cassette sub-family D member 3, PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)), ZWS2

Gene Symbol

ABCD3

Additional PMP70 Products

Product Documents for PMP70 Antibody (3V4K3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PMP70 Antibody (3V4K3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMP70 Antibody (3V4K3)

There are currently no reviews for this product. Be the first to review PMP70 Antibody (3V4K3) and earn rewards!

Have you used PMP70 Antibody (3V4K3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies