Podocin/NPHS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33570

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Podocin/NPHS2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Podocin/NPHS2 Antibody - BSA Free (NBP2-33570) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Podocin/NPHS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Analysis in human kidney and tonsil tissues using NBP2-33570 antibody. Corresponding NPHS2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human Placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570]

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

Applications for Podocin/NPHS2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Podocin/NPHS2

NPHS2 encodes the glomerular protein podocin which plays a role in the regulation of glomerular permeability, and acts as a linker between the plasma membrane and the cytoskeleton. Defects in this gene are the cause of autosomal recessive steroid-resistant nephrotic syndrome (SRN). SRN is characterized by onset between three months and five years, resistance to steroid therapy and rapid progression to end-stage renal disease. An alternative splice variant has been described but its full length sequence has not been determined. [provided by RefSeq]

Alternate Names

Nephrosis 2, NPHS2, PDCN, SRN1

Gene Symbol

NPHS2

UniProt

Q9NP85

Additional Podocin/NPHS2 Products

Product Documents for Podocin/NPHS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Podocin/NPHS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Immunoglobulin Superfamily CAMs

Customer Reviews for Podocin/NPHS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Podocin/NPHS2 Antibody - BSA Free and earn rewards!

Have you used Podocin/NPHS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies