POLR3G Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-55778
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Rat (90%). Backed by our 100% Guarantee.
Applications
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWR
Reactivity Notes
Mouse 88%
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for POLR3G Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: POLR3G Antibody [NBP2-55778]
Immunocytochemistry/Immunofluorescence: POLR3G Antibody [NBP2-55778] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.Chromatin Immunoprecipitation-exo-Seq: POLR3G Antibody - BSA Free [NBP2-55778]
ChIP-Exo-Seq composite graph for Anti-POLR3G (NBP2-55778) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Applications for POLR3G Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: POLR3G
Alternate Names
DNA-directed RNA polymerase III 32 kDa polypeptide, DNA-directed RNA polymerase III subunit G, DNA-directed RNA polymerase III subunit RPC7, polymerase (RNA) III (DNA directed) polypeptide G (32kD), RNA polymerase III 32 kDa subunit, RNA polymerase III subunit C7, RPC32RPC7
Gene Symbol
POLR3G
Additional POLR3G Products
Product Documents for POLR3G Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for POLR3G Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for POLR3G Antibody - BSA Free
There are currently no reviews for this product. Be the first to review POLR3G Antibody - BSA Free and earn rewards!
Have you used POLR3G Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...