POR/Cytochrome P450 Reductase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59780

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all POR/Cytochrome P450 Reductase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to POR(P450 (cytochrome) oxidoreductase) The peptide sequence was selected form the middle region of POR. Peptide sequence VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for POR/Cytochrome P450 Reductase Antibody - BSA Free

Western Blot: POR/Cytochrome P450 Reductase Antibody [NBP1-59780]

Western Blot: POR/Cytochrome P450 Reductase Antibody [NBP1-59780]

Western Blot: Cytochrome P450 Reductase Antibody [NBP1-59780] - Titration: 0.25ug/ml Positive Control: 293T cells lysate.
Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody [NBP1-59780]

Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody [NBP1-59780]

Immunohistochemistry-Paraffin: Cytochrome P450 Reductase Antibody [NBP1-59780] - tissue at an antibody concentration of 4-8ug/ml.

Applications for POR/Cytochrome P450 Reductase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POR/Cytochrome P450 Reductase

POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

NADPH Cytochrome P450 Reductase

Alternate Names

CPR, CYPOR, Cytochrome P450 Reductase, P450R

Gene Symbol

POR

OMIM

NP_000932 (Human)

UniProt

Q63HL4 (Human)

Additional POR/Cytochrome P450 Reductase Products

Product Documents for POR/Cytochrome P450 Reductase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for POR/Cytochrome P450 Reductase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Redox Enzymes

Customer Reviews for POR/Cytochrome P450 Reductase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POR/Cytochrome P450 Reductase Antibody - BSA Free and earn rewards!

Have you used POR/Cytochrome P450 Reductase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies