POU2F3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21362

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all POU2F3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFNSSGSWYRWNHSTYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POU2F3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: POU2F3 Antibody [NBP3-21362] -

Immunocytochemistry/Immunofluorescence: POU2F3 Antibody [NBP3-21362] -

Staining of human cell line A-431 shows localization to nucleoplasm, nucleoli & plasma membrane.
POU2F3 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: POU2F3 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: POU2F3 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-POU2F3 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for POU2F3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POU2F3

POU2F3, also referred to as POU domain, class 2, transcription factor 3, is a transcription factor that belongs to the POU protein family. POU2F3 has a 436 amino acid long isoform, a 438 amino acid long isoform, and a 432 amino acid long isoform, all three of which are approximately 47kDa. POU2F3 is highly expressed in keratinocytes and the epidermis. Current research surrounding POU2F3 has shown possible interactions with diseases and disorders such as atherosclerosis, bipolar disorder, herpes, cervical cancer, breast cancer, and neuroendocrine tumors. POU2F3 has also been shown to interact with Bcl6, Ubiquitin and KAT3A/CBP.

Long Name

POU class 2 homeobox 3

Alternate Names

Epoc-1, OCT-11, OCT11, OTF-11, PLA-1, PLA1, Skn-1a

Gene Symbol

POU2F3

Additional POU2F3 Products

Product Documents for POU2F3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for POU2F3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POU2F3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POU2F3 Antibody - BSA Free and earn rewards!

Have you used POU2F3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies