PP14/Glycodelin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89781

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PP14/Glycodelin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PP14/Glycodelin Antibody - BSA Free (NBP1-89781) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PP14/Glycodelin Antibody - BSA Free

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Staining of human cerebral cortex, endometrium, prostate and testis using Anti-PP14/Glycodelin antibody NBP1-89781 (A) shows similar protein distribution across tissues to independent antibody NBP1-89782 (B).
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Analysis in human endometrium and prostate tissues. Corresponding PP14/Glycodelin RNA-seq data are presented for the same tissues.
PP14/Glycodelin Antibody - BSA Free Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody - BSA Free [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody - BSA Free [NBP1-89781]

Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody [NBP1-89781] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
PP14/Glycodelin Antibody - BSA Free Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody - BSA Free [NBP1-89781]

Immunohistochemistry-Paraffin: PP14/Glycodelin Antibody - BSA Free [NBP1-89781]

Staining of human cerebral cortex shows no positivity in neurons as expected.
PP14/Glycodelin Antibody - BSA Free Western Blot: PP14/Glycodelin Antibody - BSA Free [NBP1-89781]

Western Blot: PP14/Glycodelin Antibody - BSA Free [NBP1-89781]

Analysis in human placenta tissue.

Applications for PP14/Glycodelin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PP14/Glycodelin

PAEP (Progesterone-associated endometrial protein, glycodelin, PEG, PP14) is a glycoprotein belonging to lipocalin structural superfamily. It shares a sequence homology to beta-lactoglobulins containing a retinol-binding motif and it is mainly produced by secretory and decidualized endometrium in women and by seminal vesicle epithelium in men (1). PAEP function is not clearly understood. However, glycosylated version of PAEP (GdA) has been associated to contraceptive and immunosuppressive activities during reproduction. PAEP is the main protein produced by secretory endometrium during mid-luteal phase of the menstrual cycle and during the first semester of pregnancy. Therefore, PAEP has been linked as an ideal biomarker of endometrial activity and function for in vitro fertilization treated women (2).

Long Name

Placental Protein 14

Alternate Names

Glycodelin, PAEP

Gene Symbol

PAEP

Additional PP14/Glycodelin Products

Product Documents for PP14/Glycodelin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PP14/Glycodelin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Reproduction

Customer Reviews for PP14/Glycodelin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PP14/Glycodelin Antibody - BSA Free and earn rewards!

Have you used PP14/Glycodelin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies