PPAP2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59025

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PPAP2A(phosphatidic acid phosphatase type 2A) The peptide sequence was selected from the middle region of PPAP2A. Peptide sequence DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PPAP2A Antibody - BSA Free

Western Blot: PPAP2A Antibody [NBP1-59025]

Western Blot: PPAP2A Antibody [NBP1-59025]

Western Blot: PPAP2A Antibody [NBP1-59025] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: PPAP2A Antibody [NBP1-59025]

Immunohistochemistry-Paraffin: PPAP2A Antibody [NBP1-59025]

Immunohistochemistry-Paraffin: PPAP2A Antibody [NBP1-59025] - Mouse primary focusing in pLN, 1 mg/ml. Secondary Dilution: 125 ug/ml

Applications for PPAP2A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPAP2A

PPAP2A is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of PPAP2A is found to be regulated by androgen in a prostatic adenocarcinoma cell line.The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of this gene is found to be regulated by androgen in a prostatic adenocarcinoma cell line. At least two alternatively spliced transcript variants encoding distinct isoforms have been described.

Alternate Names

EC 3.1.3.4, lipid phosphate phosphohydrolase 1, lipid phosphate phosphohydrolase 1a, LLP1a, LPP1PAP2a2, PAP2, PAP2a, PAP2-alpha, PAP-2aPAP2alpha2, PAPalpha1, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, phosphatidic acid phosphatase type 2A, phosphatidic acid phosphohydrolase type 2a, type 2 phosphatidic acid phosphohydrolase, type-2 phosphatidic acid phosphatase alpha

Entrez Gene IDs

8611 (Human)

Gene Symbol

PLPP1

Additional PPAP2A Products

Product Documents for PPAP2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPAP2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPAP2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPAP2A Antibody - BSA Free and earn rewards!

Have you used PPAP2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...