PPP2R2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92283

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPP2R2B Antibody - BSA Free

Immunohistochemistry-Paraffin: PPP2R2B Antibody [NBP1-92283]

Immunohistochemistry-Paraffin: PPP2R2B Antibody [NBP1-92283]

Immunohistochemistry-Paraffin: PPP2R2B Antibody [NBP1-92283] - Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in purkinje cells.

Applications for PPP2R2B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPP2R2B

The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. This gene encodes a beta isoform of the regulatory subunit B55 subfamily. Defects in the 5' UTR of this gene may cause a rare form of autosomal dominant spinocerebellar ataxia 12 (SCA12).

Alternate Names

B55BETA, FLJ95686, MGC24888, PP2A subunit B isoform B55-beta, PP2A subunit B isoform beta, PP2A subunit B isoform PR55-beta, PP2A subunit B isoform R2-beta, PP2A, subunit B, B-beta isoform, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55BETA, PR55-BETA, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform, protein phosphatase 2, regulatory subunit B, beta, SCA12, serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform, serine/threonine protein phosphatase 2A, neuronal isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform, spinocerebellar ataxia 12

Gene Symbol

PPP2R2B

Additional PPP2R2B Products

Product Documents for PPP2R2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPP2R2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPP2R2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPP2R2B Antibody - BSA Free and earn rewards!

Have you used PPP2R2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...