PPP3CC Antibody (4D1) - Azide and BSA Free

Novus Biologicals | Catalog # H00005533-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4D1

Format

Azide and BSA Free
View all PPP3CC Primary Antibodies »

Product Specifications

Immunogen

PPP3CC (NP_005596.2, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI

Specificity

This product is specific for Human PPP3CC monoclonal antibody (M01), clone 4D1 [Gene ID: 5533].

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for PPP3CC Antibody (4D1) - Azide and BSA Free

Western Blot: PPP3CC Antibody (4D1) [H00005533-M01]

Western Blot: PPP3CC Antibody (4D1) [H00005533-M01]

Western Blot: PPP3CC Antibody (4D1) [H00005533-M01] - Analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: PPP3CC Antibody (4D1) [H00005533-M01] - Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.

Applications for PPP3CC Antibody (4D1) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PPP3CC

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).[supplied by OMIM]

Long Name

Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform

Alternate Names

CALNA3, CNA3

Gene Symbol

PPP3CC

UniProt

NP_005596.2 (Human)

Additional PPP3CC Products

Product Documents for PPP3CC Antibody (4D1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PPP3CC Antibody (4D1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPP3CC Antibody (4D1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PPP3CC Antibody (4D1) - Azide and BSA Free and earn rewards!

Have you used PPP3CC Antibody (4D1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies