PQBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38089

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human PQBP1 (NP_005701.1).

Sequence:
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PQBP1 Antibody - BSA Free

PQBP1 Antibody

Western Blot: PQBP1 Antibody [NBP3-38089] -

Western Blot: PQBP1 Antibody [NBP3-38089] - Western blot analysis of various lysates using PQBP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for PQBP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PQBP1

PQBP1, also known as Polyglutamine-binding protein 1, is a nuclear polyglutamine-binding protein that may play a role in apoptosis and DNA replication. Ten isoforms of PQBP1 have been identified which are produced by alternative splicing. The canonical sequence, referred to as PQBP-1, is 265 amino acids long and approximately 30kdA. PQBP1 may be implicated in an x-linked mental retardation syndrome called Renpenning syndrome 1 (RENS1), as well as neurodegenerative diseases, coloboma, spastic diplegia, ataxia and neuronitis. PQBP1 has also been shown to interact with C14orf1, MED31, WBP11, CLTB, and SF3A2.

Alternate Names

38 kDa nuclear protein containing a WW domain, MRX55, MRXS3, MRXS8, Npw38, NPW38mental retardation, X-linked 55, nuclear protein containing WW domain 38 kD, polyglutamine binding protein 1, Polyglutamine tract-binding protein 1, polyglutamine-binding protein 1, PQBP-1, RENS1, SHS, Sutherland-Haan X-linked mental retardation syndrome

Gene Symbol

PQBP1

Additional PQBP1 Products

Product Documents for PQBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PQBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PQBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PQBP1 Antibody - BSA Free and earn rewards!

Have you used PQBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...