Proprotein Convertase 2/PCSK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69146

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Proprotein Convertase 2/PCSK2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Proprotein Convertase 2/PCSK2 Antibody - BSA Free

Western Blot: Proprotein Convertase 2/PCSK2 Antibody [NBP1-69146]

Western Blot: Proprotein Convertase 2/PCSK2 Antibody [NBP1-69146]

Western Blot: Proprotein Convertase 2 Antibody [NBP1-69146] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Applications for Proprotein Convertase 2/PCSK2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proprotein Convertase 2/PCSK2

This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in hormone biosynthesis by processing a variety of prohormones including proinsulin, proopiomelanocortin and proluteinizing-hormone-releasing hormone. Single nucleotide polymorphisms in this gene may increase susceptibility to myocardial infarction and type 2 diabetes. This gene may also play a role in tumor development and progression. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Long Name

Proprotein Convertase Subtilisin/Kexin Type 2

Alternate Names

NEC2, PC2, PCSK2, SPC2

Gene Symbol

PCSK2

Additional Proprotein Convertase 2/PCSK2 Products

Product Documents for Proprotein Convertase 2/PCSK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Proprotein Convertase 2/PCSK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Proprotein Convertase 2/PCSK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Proprotein Convertase 2/PCSK2 Antibody - BSA Free and earn rewards!

Have you used Proprotein Convertase 2/PCSK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies