Prosurfactant Protein C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60117

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Prosurfactant Protein C Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide corresponding to SFTPC (surfactant, pulmonary-associated protein C). The peptide sequence was selected from the N terminal of SFTPC. Peptide sequence MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Prosurfactant Protein C Antibody - BSA Free

Western Blot: Prosurfactant Protein C Antibody [NBP1-60117]

Western Blot: Prosurfactant Protein C Antibody [NBP1-60117]

Western Blot: Prosurfactant Protein C Antibody [NBP1-60117] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.
Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-60117]

Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-60117]

Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-60117] - Human Lung tissue. Antibody at 5 ug/mL.

Applications for Prosurfactant Protein C Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10 - 1:500

Immunohistochemistry-Paraffin

1:10 - 1:500

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 1 using NBP1-60117 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Prosurfactant Protein C

This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids

Alternate Names

PSP-C, pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SFTP2, SFTP2pulmonary surfactant apoprotein-2 SP-C, SMDP2surfactant, pulmonary-associated protein C, SP-CSP5, surfactant protein C

Gene Symbol

SFTPC

UniProt

P11686 (Human)

Additional Prosurfactant Protein C Products

Product Documents for Prosurfactant Protein C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Prosurfactant Protein C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Prosurfactant Protein C Antibody - BSA Free

Customer Reviews for Prosurfactant Protein C Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used Prosurfactant Protein C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Prosurfactant Protein C Antibody
    Name: Maximillian Carlino
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Lung tissue and Liver tissue
    Species: Pig
    Verified Customer | Posted 01/12/2021
    Non-specific staining was observed in porcine lung/liver control tissues. Liver was intended to be included as a negative control. Prominent staining appeared in all nuclei of all cells in both liver and lung samples.
    Unfortunately unusable for my experiments. Tissue was blocked in 3% H2O2 in PBS for 10 minutes, then PBS containing 1%BSA + 2% FBS + 0.1% Triton X-100 overnight. Primary antibody was diluted 1:500 in the latter buffer and incubated overnight at 4C. Secondary antibody was a ready-to-use goat-anti-rabbit polymer HRP (Vector Labs MP-7451-15) and was incubated at 22C for 2 hours. 0.05% DAB + 0.015% H2O2 in PBS was used as the detection solution and incubated for 5 minutes before washing, counterstaining with hematoxylin for 3 minutes, washing, dehydrating, and mounting coverslips.
    Prosurfactant Protein C Antibody - BSA Free NBP1-60117

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies