Protocadherin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59209

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Protocadherin-1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PCDH1(protocadherin 1) The peptide sequence was selected from the N terminal of PCDH1. Peptide sequence LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Protocadherin-1 Antibody - BSA Free

Western Blot: Protocadherin-1 Antibody [NBP1-59209]

Western Blot: Protocadherin-1 Antibody [NBP1-59209]

Western Blot: Protocadherin-1 Antibody [NBP1-59209] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
Immunocytochemistry/ Immunofluorescence: Protocadherin-1 Antibody [NBP1-59209]

Immunocytochemistry/ Immunofluorescence: Protocadherin-1 Antibody [NBP1-59209]

Immunocytochemistry/Immunofluorescence: Protocadherin-1 Antibody [NBP1-59209] - Bronchial epithelial cell line (16HBE).
Western Blot: Protocadherin-1 Antibody [NBP1-59209]

Western Blot: Protocadherin-1 Antibody [NBP1-59209]

Western Blot: Protocadherin-1 Antibody [NBP1-59209] - N-terminal region validated by WB using bronchial epithelial cell line (16HBE).

Applications for Protocadherin-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protocadherin-1

PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene.

Alternate Names

PC42, PCDH1, PCDH42, Protocadherin1

Gene Symbol

PCDH1

UniProt

Q08174

Additional Protocadherin-1 Products

Product Documents for Protocadherin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Protocadherin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cadherin Superfamily

Customer Reviews for Protocadherin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protocadherin-1 Antibody - BSA Free and earn rewards!

Have you used Protocadherin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies