Protocadherin 21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92296

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%). Reactivity reported in the rat olfactory bulb from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Protocadherin 21 Antibody - BSA Free

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296] - Strong protocadherin 21 (Pcdh21) labelling of mitral and tufted cells in the rat olfactory bulb (PND 15). Perfusion with 4% PFA, 30 um Cryocut brain slices. Image submitted by a verified customer review
Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human eye, retina shows moderate cytoplasmic and membranous positivity in cells in photoreceptor layer.
Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry: Protocadherin 21 Antibody [NBP1-92296]

Immunohistochemistry: Protocadherin 21 Antibody [NBP1-92296] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for Protocadherin 21 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Frozen

Validated from a verified customer review.

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP1-92296 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protocadherin 21

Protocadherin 21 is a member of the cadherin superfamily of calcium-dependent cell-cell adhesion molecules. The encoded protein has a signal peptide, six cadherin repeat domains and a unique cytoplasmic region. This non-classical cadherin appears to be exclusively expressed in the mitral and tufted cells in the main and accessory olfactory bulbs of the brain, suggesting a possible role in the formation and maintenance of neuronal networks. [provided by RefSeq]

Alternate Names

cadherin-related family member 1, CORD15, KIAA1775DKFZp434A132, PCDH21MT-protocadherin, Photoreceptor cadherin, prCAD, PRCADprotocadherin-21, protocadherin 21, Protocadherin-21

Gene Symbol

CDHR1

Additional Protocadherin 21 Products

Product Documents for Protocadherin 21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Protocadherin 21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Protocadherin 21 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Protocadherin 21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Protocadherin 21 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: Rat olfactory bulb, mouse olfactory bulb
    Species: Rat
    Verified Customer | Posted 05/09/2018
    Strong protocadherin 21 (Pcdh21) labelling of mitral and tufted cells in the rat olfactory bulb (PND 15).
    Perfusion with 4% PFA 30 µm Cryocut brain slices DAB-Staining
    Protocadherin 21 Antibody - BSA Free NBP1-92296

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...