PRUNE Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84055

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PRUNE Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PRUNE Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PRUNE Antibody [NBP1-84055]

Immunocytochemistry/ Immunofluorescence: PRUNE Antibody [NBP1-84055]

Immunocytochemistry/Immunofluorescence: PRUNE Antibody [NBP1-84055] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil, as well as positivity in endothelial cells.
Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human liver shows only very weak positivity in hepatocytes.
Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human lower rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055]

Immunohistochemistry-Paraffin: PRUNE Antibody [NBP1-84055] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
PRUNE Antibody - BSA Free Western Blot: PRUNE Antibody - BSA Free [NBP1-84055]

Western Blot: PRUNE Antibody - BSA Free [NBP1-84055]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for PRUNE Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRUNE

Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cellproliferation, is able to induce cell motility and acts as a negative regulator of NME1

Alternate Names

BMCC1, DRES17, DRES-17EC 3.6.1.1, Drosophila-related expressed sequence 17, hPrune, HTcD37, KIAA0367, protein prune homolog, prune homolog (Drosophila), PRUNE2

Gene Symbol

PRUNE1

Additional PRUNE Products

Product Documents for PRUNE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRUNE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRUNE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRUNE Antibody - BSA Free and earn rewards!

Have you used PRUNE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies