PSMB7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13821

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMB7 Antibody - BSA Free

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining of human liver shows positivity in hepatocytes.
Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells and peripheral nerve/ganglion.
Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining in human testis and pancreas tissues using anti-PSMB7 antibody. Corresponding PSMB7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining of human skin shows moderate nuclear positivity in epidermal cells.
Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining of human testis shows positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821]

Immunohistochemistry-Paraffin: PSMB7 Antibody [NBP2-13821] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Applications for PSMB7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMB7

PSMB7 (proteasome subunit, beta-type 7), also called proteasome subunit Z, is a widely expressed, non-catalytic component of the 20S proteasome core within the 26S proteasome that stabilizes late stages of proteasome assembly. Human PSMB7 is synthesized as a 277 amino acid (aa) protein with a 43 aa propeptide and a 234 active protein that contains one potential tyrosine phosphorylation site. Total PSMB7 expression is positively correlated with chemotherapy resistance in human breast cancer.

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 7

Alternate Names

Macropain Chain Z, Proteasome Subunit Z

Gene Symbol

PSMB7

Additional PSMB7 Products

Product Documents for PSMB7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSMB7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PSMB7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMB7 Antibody - BSA Free and earn rewards!

Have you used PSMB7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...